PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc002744.1_g00008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family FAR1
Protein Properties Length: 431aa    MW: 49268.6 Da    PI: 8.4049
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc002744.1_g00008.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR161.91.9e-1921108291
                     FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnH 87 
                               Yn+YA++vGFsvrk k++++  +++++++tf Csk g++++e+     +  ++   rtgC a ++   + +g+  vtk e+ HnH
  Itr_sc002744.1_g00008.1  21 LYNDYAYRVGFSVRKGKQRYQGSTKNVKMKTFLCSKAGRKSKENIC--VKAYSKIDLRTGCGAFVQFDVDGNGVGTVTKHEKAHNH 104
                              7**************************************9998877..8889999******************************* PP

                     FAR1  88 elap 91 
                              el++
  Itr_sc002744.1_g00008.1 105 ELCT 108
                              **95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.2E-1521107IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 431 aa     Download sequence    Send to blast
CAVDQDLVGI VVSNGDEAYE LYNDYAYRVG FSVRKGKQRY QGSTKNVKMK TFLCSKAGRK  60
SKENICVKAY SKIDLRTGCG AFVQFDVDGN GVGTVTKHEK AHNHELCTLD KSHLLRSHRR  120
VGNNQLSYLR DLKKSGVALA DVIRRRQCNE SDFFNFEVDG DARLTSFFWR DEQMRRDYEL  180
FGDFHGCFHL SSVYNITTSS LHMAYRYSKK HIKTLRNNKD FMDLFNCLLK YTDIEVEFEL  240
YWSRSKENGE DFRCAQGMPS LMMDDVKFLS HAREVYTIEI YYLFEEQFLK ARQCCEEAFE  300
SAKKSVETEV GYVHIEESDV SSSSGIVQDP SSRRLKGERN KRRSSIIILK RNLLADLKAF  360
TATLNRDIGS SSSMPSASDT VPDAAGDYLR QRQLRTQKVP TNCVYGICAW STPDAKKSKT  420
PDANAPFCTS D
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14143211
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-10FAR1-related sequence 5